PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa02g005830.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HB-other
Protein Properties Length: 985aa    MW: 108964 Da    PI: 6.8621
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa02g005830.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox171e-05107163157
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                     +r+R  ++++  + L+++F+ +  +s++e +e+++  g+t +qV+ +F  ++++ +k
  Csa02g005830.1 107 KRPRDLLNPKAAKYLQAVFAVKDAISKRESREISALFGITVAQVRDFFVTQKTRVRK 163
                     799*********************************************999999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.329104164IPR001356Homeobox domain
SuperFamilySSF466892.91E-5106166IPR009057Homeodomain-like
SMARTSM003894.9E-4106168IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.0E-4107166IPR009057Homeodomain-like
CDDcd000860.00461107164No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006351Biological Processtranscription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 985 aa     Download sequence    Send to blast
MDEIEIGSSV ESLMELLDSQ KELFHSQIDQ LQDVVVAQCK LTGVNPLAQE MLDLVASSVN  60
LVSFGDENFA SQFNFWSRLY CNGDGSAVYK LLLPCQAAGA LSIKIGKRPR DLLNPKAAKY  120
LQAVFAVKDA ISKRESREIS ALFGITVAQV RDFFVTQKTR VRKQVRLSRE KLILPNSDAI  180
RGDGVPENNN ATNHVDPVPL NSVHPEACSI SWGEGETVTL MPPEDIPPDI SDSDKYFVEN  240
IFSLLGKEET FSGQVKLMEW IMQIQDSSVL IWFLSKGGVL ILTTWLSQAA AEEQTSVLLL  300
ILKVLCHLPL HKASPENMSA ILQSVNGLRF YRTIAEIMGD TSNPEDILSL TNGRSENVRR  360
IESSQGPKLL LTSADDSTKK HMLGSTPSCI LIIAEIMGDT SNPEDILSLT NGRSENVRRI  420
ESSQGPKLLL TSADDSTKKH MLGSTPSYNK ERRKVQMVEQ PGQKAAGKSP QTVRIGTSSR  480
SRPMSADDIQ KAKMRALYMQ SKNSKKDPLP SAIGDSKTIV PEKPLALQSS KDFPPSQNSE  540
AKTEDTNVPS VEPSAIQPVN GPAIIVPIQT DEIKKPFLTP SKSISNKVGI LVKMSPQTIL  600
KNCKRIQIDW HVPPGMELDE AWRVAAGGNS KEADVQRNRN RRERETTYQS LQNIPLNPKE  660
PWDREMDYDD SLTLEIPSLQ SPEESSTEPQ ESLDERRTTA GAATTSSSIS CPEPDLELLA  720
ALLKNPDLVY ALTSGKPSNL AGQDMVKLLD VIKTGAPTSS SSSNKQVEEK VEVSLPSPTP  780
ATNPGMSGWG QEAIRNPFSR QNQVGAAVAR SGTHLHVTSM QWKSTNEQAI PRHATAAYNN  840
SVILSHTERQ QQQQQQMQPQ LHHNHHLQQQ PISTTSYAVR EPVGQMGTAT SSGSWRSQQS  900
QNSYYSHQGN EIALASQASS YQGNNQQYMS SNREYESWSP DHSPSRNHPN VRGQQQQQQQ  960
QQQQPSRKYD SSSHPYWNQN KRWR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2267460.0AK226746.1 Arabidopsis thaliana mRNA for luminidependens protein, complete cds, clone: RAFL07-75-C15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010429826.10.0PREDICTED: homeobox protein LUMINIDEPENDENS-like
RefseqXP_010429834.10.0PREDICTED: homeobox protein LUMINIDEPENDENS-like
SwissprotQ387960.0LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLD7M3G50.0D7M3G5_ARALL; Putative uncharacterized protein
STRINGscaffold_604015.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM108762428
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.20.0HB-other family protein